ZP1 anticorps
-
- Antigène Voir toutes ZP1 Anticorps
- ZP1 (Zona Pellucida Glycoprotein 1 (ZP1))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ZP1 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- ZP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PVGFEDSYGQEPTLGPTDSNGNSSLRPLLWAVLLLPAVALVLGFGVFVGL
- Top Product
- Discover our top product ZP1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ZP1 Blocking Peptide, catalog no. 33R-7410, is also available for use as a blocking control in assays to test for specificity of this ZP1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZP1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ZP1 (Zona Pellucida Glycoprotein 1 (ZP1))
- Autre désignation
- ZP1 (ZP1 Produits)
- Synonymes
- anticorps zona pellucida glycoprotein 1 (sperm receptor), anticorps zona pellucida glycoprotein 1, anticorps ZP1, anticorps Zp1
- Sujet
- The mammalian zona pellucida, which mediates species-specific sperm binding, induction of the acrosome reaction and prevents post-fertilization polyspermy, is composed of three to four glycoproteins, ZP1, ZP2, ZP3, and ZP4. ZP1 ensures the structural integrity of the zona pellucida.
- Poids moléculaire
- 70 kDa (MW of target protein)
-