JAM3 anticorps (N-Term)

N° du produit ABIN635598

Détail du produit anti-JAM3 anticorps

Antigène: JAM3 (Junctional Adhesion Molecule 3 (JAM3))

Épitope: N-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp JAM3 est non-conjugé

Application: Western Blotting (WB)

Specificité: JAM3 antibody was raised against the N terminal of JAM3

Purification: Affinity purified

Immunogène: JAM3 antibody was raised using the N terminal of JAM3 corresponding to a region with amino acids SSNRTPVVQEFESVELSCIITDSQTSDPRIEWKKIQDEQTTYVFFDNKIQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

JAM3 Blocking Peptide, catalog no. 33R-8834, is also available for use as a blocking control in assays to test for specificity of this JAM3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of JAM3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur JAM3

Antigène: JAM3 (Junctional Adhesion Molecule 3 (JAM3))

Autre désignation: JAM3 (JAM3 Produits)

Synonymes: anticorps JAM3, anticorps jam3, anticorps sr:nyz155, anticorps wu:fb30h11, anticorps wu:fc08c06, anticorps wu:fc13e04, anticorps wu:fc25g11, anticorps jamc.2, anticorps 1110002N23Rik, anticorps JAM-3, anticorps JAM-C, anticorps Jcam3, anticorps JAM-2, anticorps JAMC, anticorps junctional adhesion molecule 3, anticorps junctional adhesion molecule 3b, anticorps junctional adhesion molecule 3a, anticorps junction adhesion molecule 3, anticorps JAM3, anticorps jam3b, anticorps jam3a, anticorps Jam3

Sujet: Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. JAM3, one member of the immunoglobulin superfamily, is localized in the tight junctions between high endothelial cells. Unlike other proteins in this family, this protein is unable to adhere to leukocyte cell lines and only forms weak homotypic interactions. JAM3 is a member of the junctional adhesion molecule protein family and acts as a receptor for another member of this family.

Poids moléculaire: 28 kDa (MW of target protein)