COX3 anticorps (C-Term)

N° du produit ABIN635599

Détail du produit anti-COX3 anticorps

Antigène: COX3 (COX-3) (Cytochrome C Oxidase Subunit 3 (COX-3))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp COX3 est non-conjugé

Application: Western Blotting (WB)

Specificité: COX3 antibody was raised against the C terminal of COX3

Purification: Affinity purified

Immunogène: COX3 antibody was raised using the C terminal of COX3 corresponding to a region with amino acids FESPFTISDGIYGSTFFVATGFHGLHVIIGSTFLTICFIRQLMFHFTSKH

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

COX3 Blocking Peptide, catalog no. 33R-2880, is also available for use as a blocking control in assays to test for specificity of this COX3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of COX3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur COX3

Antigène: COX3 (COX-3) (Cytochrome C Oxidase Subunit 3 (COX-3))

Autre désignation: COX3 (COX-3 Produits)

Synonymes: anticorps COIII, anticorps MTCO3, anticorps cytochrome c oxidase III, anticorps cytochrome c oxidase subunit III, anticorps cytochrome c oxidase subunit 3, anticorps cytochrome oxidasesubunit 3, anticorps COX3, anticorps cox3

Sujet: COX3 is a multi-pass membrane protein. It belongs to the cytochrome c oxidase subunit 3 family. Defects in COX3 are a cause of Leber hereditary optic neuropathy (LHON) and cytochrome c oxidase deficiency (COX deficiency). Defects in MT-CO3 are also found in mitochondrial encephalomyopathy with lactic acidosis and stroke-like episodes (MELAS) syndrome and recurrent myoglobinuria.

Poids moléculaire: 29 kDa (MW of target protein)