Cytochrome b anticorps (N-Term)

N° du produit ABIN635601

Détail du produit anti-Cytochrome b anticorps

Antigène: Cytochrome b (MT-CYB) (Mitochondrially Encoded Cytochrome B (MT-CYB))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Cytochrome b est non-conjugé

Application: Western Blotting (WB)

Specificité: CYTB antibody was raised against the N terminal of CYTB

Purification: Affinity purified

Immunogène: CYTB antibody was raised using the N terminal of CYTB corresponding to a region with amino acids TPMRKINPLMKLINHSFIDLPTPSNISAWWNFGSLLGACLILQITTGLFL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CYTB Blocking Peptide, catalog no. 33R-9225, is also available for use as a blocking control in assays to test for specificity of this CYTB antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYTB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Cytochrome b

Antigène: Cytochrome b (MT-CYB) (Mitochondrially Encoded Cytochrome B (MT-CYB))

Autre désignation: CYTB (MT-CYB Produits)

Synonymes: anticorps cytB, anticorps cytb, anticorps MTCYB, anticorps cytochrome b, anticorps CYTB

Sujet: CYTB belongs to the cytochrome b family. It is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is a respiratory chain that generates an electrochemical potential coupled to ATP synthesis.

Poids moléculaire: 42 kDa (MW of target protein)

Pathways: Proton Transport