SLC26A4 anticorps (Middle Region)

N° du produit ABIN635614

Détail du produit anti-SLC26A4 anticorps

Antigène: SLC26A4 (Solute Carrier Family 26, Member 4 (SLC26A4))

Épitope: Middle Region

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC26A4 est non-conjugé

Application: Western Blotting (WB)

Specificité: SLC26 A4 antibody was raised against the middle region of SLC26 4

Purification: Affinity purified

Immunogène: SLC26 A4 antibody was raised using the middle region of SLC26 4 corresponding to a region with amino acids ELNDRFRHKIPVPIPIEVIVTIIATAISYGANLEKNYNAGIVKSIPRGFL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC26A4 Blocking Peptide, catalog no. 33R-2563, is also available for use as a blocking control in assays to test for specificity of this SLC26A4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLC26A4

Antigène: SLC26A4 (Solute Carrier Family 26, Member 4 (SLC26A4))

Autre désignation: SLC26A4 (SLC26A4 Produits)

Synonymes: anticorps Pds, anticorps DFNB4, anticorps EVA, anticorps PDS, anticorps TDH2B, anticorps pendrin, anticorps solute carrier family 26 member 4, anticorps solute carrier family 26, member 4, anticorps SLC26A4, anticorps Slc26a4

Sujet: Mutations in this gene are associated with Pendred syndrome, the most common form of syndromic deafness, an autosomal-recessive disease. It is highly homologous to the SLC26A3 gene.

Poids moléculaire: 86 kDa (MW of target protein)

Pathways: Thyroid Hormone Synthesis, Sensory Perception of Sound