CLMN anticorps

N° du produit ABIN635615

Détail du produit anti-CLMN anticorps

Antigène: CLMN (Calmin (CLMN))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CLMN est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: Calmin antibody was raised using a synthetic peptide corresponding to a region with amino acids SPSSSLSPGSGGTDSDSSFPPTPTAERSVAISVKDQRKAIKALLAWVQRK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Calmin Blocking Peptide, catalog no. 33R-8697, is also available for use as a blocking control in assays to test for specificity of this Calmin antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLMN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CLMN

Antigène: CLMN (Calmin (CLMN))

Autre désignation: Calmin (CLMN Produits)

Synonymes: anticorps 9330188N17Rik, anticorps AI428889, anticorps AI788815, anticorps mKIAA1188, anticorps uncharacterized protein PFB0145c, anticorps calmin, anticorps LOC5569762, anticorps CpipJ_CPIJ015331, anticorps Clmn, anticorps CLMN

Sujet: CLMN is a single-pass type IV membrane protein. It contains 1 actin-binding domain and 2 CH (calponin-homology) domains. The exact function of CLMN remains unknown.

Poids moléculaire: 110 kDa (MW of target protein)