YIPF6 anticorps (C-Term)

N° du produit ABIN635621

Détail du produit anti-YIPF6 anticorps

Antigène: YIPF6 (Yip1 Domain Family, Member 6 (YIPF6))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp YIPF6 est non-conjugé

Application: Western Blotting (WB)

Specificité: YIPF6 antibody was raised against the C terminal of YIPF6

Purification: Affinity purified

Immunogène: YIPF6 antibody was raised using the C terminal of YIPF6 corresponding to a region with amino acids MVRLFVVIVMFAWSIVASTALLADSQPPNRRALAVYPVFLFYFVISWMIL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

YIPF6 Blocking Peptide, catalog no. 33R-6602, is also available for use as a blocking control in assays to test for specificity of this YIPF6 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of YIPF6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur YIPF6

Antigène: YIPF6 (Yip1 Domain Family, Member 6 (YIPF6))

Autre désignation: YIPF6 (YIPF6 Produits)

Sujet: YIPF6 is a multi-pass membrane proteinPotential. It belongs to the YIP1 family. The exact function of YIPF6 remains unknown.

Poids moléculaire: 26 kDa (MW of target protein)