SYT9 anticorps (Middle Region)
-
- Antigène Voir toutes SYT9 Anticorps
- SYT9 (Synaptotagmin IX (SYT9))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SYT9 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- SYT9 antibody was raised against the middle region of SYT9
- Purification
- Affinity purified
- Immunogène
- SYT9 antibody was raised using the middle region of SYT9 corresponding to a region with amino acids PDFNIQQLQKQEQLTGIGRIKPELYKQRSLDNDDGRRSNSKACGKLNFIL
- Top Product
- Discover our top product SYT9 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SYT9 Blocking Peptide, catalog no. 33R-7008, is also available for use as a blocking control in assays to test for specificity of this SYT9 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SYT9 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SYT9 (Synaptotagmin IX (SYT9))
- Autre désignation
- SYT9 (SYT9 Produits)
- Synonymes
- anticorps Sytv, anticorps zgc:91875, anticorps synaptotagmin IX, anticorps synaptotagmin 9, anticorps synaptotagmin IXb, anticorps Syt9, anticorps SYT9, anticorps syt9, anticorps syt9b
- Sujet
- SYT9 may be involved in Ca2+-dependent exocytosis of secretory vesicles through Ca2+ and phospholipid binding to the C2 domain or may serve as Ca2+ sensors in the process of vesicular trafficking and exocytosis.
- Poids moléculaire
- 56 kDa (MW of target protein)
-