Klotho beta anticorps (Middle Region)

N° du produit ABIN635626

Détail du produit anti-Klotho beta anticorps

Antigène: Klotho beta (KLB)

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Klotho beta est non-conjugé

Application: Western Blotting (WB)

Specificité: Klotho Beta antibody was raised against the middle region of KLB

Purification: Affinity purified

Immunogène: Klotho Beta antibody was raised using the middle region of KLB corresponding to a region with amino acids DAYTIRRGLFYVDFNSKQKERKPKSSAHYYKQIIRENGFSLKESTPDVQG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Klotho Beta Blocking Peptide, catalog no. 33R-1868, is also available for use as a blocking control in assays to test for specificity of this Klotho Beta antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Klotho beta

Antigène: Klotho beta (KLB)

Autre désignation: Klotho beta (KLB Produits)

Synonymes: anticorps KLB, anticorps BKL, anticorps AV071179, anticorps betaKlotho, anticorps Klb-ps1, anticorps RGD1308227, anticorps klotho beta, anticorps KLB, anticorps Klb

Sujet: KLB is a single-pass type III membrane protein. It contributes to the transcriptional repression of cholesterol 7-alpha-hydroxylase (CYP7A1), the rate-limiting enzyme in bile acid synthesis. KLB is probably inactive as a glycosidase. It increases the ability of FGFR1 and FGFR4 to bind FGF21.

Poids moléculaire: 120 kDa (MW of target protein)

Pathways: Fc-epsilon Receptor Signaling Pathway, EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Growth Factor Binding