SAMD8 anticorps (Middle Region)

N° du produit ABIN635629

Détail du produit anti-SAMD8 anticorps

Antigène: SAMD8 (Sterile alpha Motif Domain Containing 8 (SAMD8))

Épitope: Middle Region

Reactivité: Souris, Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SAMD8 est non-conjugé

Application: Western Blotting (WB)

Specificité: SAMD8 antibody was raised against the middle region of SAMD8

Purification: Affinity purified

Immunogène: SAMD8 antibody was raised using the middle region of SAMD8 corresponding to a region with amino acids MQTYPPLPDIFLDSVPRIPWAFAMTEVCGMILCYIWLLVLLLHKHRSILL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SAMD8 Blocking Peptide, catalog no. 33R-6349, is also available for use as a blocking control in assays to test for specificity of this SAMD8 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SAMD8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SAMD8

Antigène: SAMD8 (Sterile alpha Motif Domain Containing 8 (SAMD8))

Autre désignation: SAMD8 (SAMD8 Produits)

Synonymes: anticorps CG32380, anticorps CG8572, anticorps CG8576, anticorps Css3beta, anticorps Dmel\\CG32380, anticorps dSMSr, anticorps dmSMSr, anticorps SMSr, anticorps 1110053F04Rik, anticorps 1700010P07Rik, anticorps CG32380 gene product from transcript CG32380-RA, anticorps sterile alpha motif domain containing 8, anticorps SMSr, anticorps SAMD8, anticorps samd8, anticorps Samd8

Sujet: SAMD8 is a multi-pass membrane protein. It belongs to the sphingomyelin synthase family and contains 1 SAM (sterile alpha motif) domain. The function of the SAMD8 protein remains unknown.

Poids moléculaire: 36 kDa (MW of target protein)