C5ORF4 anticorps (N-Term)

N° du produit ABIN635643

Détail du produit anti-C5ORF4 anticorps

Antigène: C5ORF4 (FAXDC2) (Fatty Acid Hydroxylase Domain Containing 2 (FAXDC2))

Épitope: N-Term

Reactivité: Humain, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp C5ORF4 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: C5 ORF4 antibody was raised against the N terminal Of C5 rf4

Purification: Affinity purified

Immunogène: C5 ORF4 antibody was raised using the N terminal Of C5 rf4 corresponding to a region with amino acids MKGEAGHMLHNEKSKQEGHIWGSMRRTAFILGSGLLSFVAFWNSVTWHLQ

Information d'application

Indications d'application: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C5ORF4 Blocking Peptide, catalog no. 33R-6138, is also available for use as a blocking control in assays to test for specificity of this C5ORF4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur C5ORF4

Antigène: C5ORF4 (FAXDC2) (Fatty Acid Hydroxylase Domain Containing 2 (FAXDC2))

Autre désignation: C5ORF4 (FAXDC2 Produits)

Synonymes: anticorps C5orf4, anticorps fatty acid hydroxylase domain containing 2, anticorps FAXDC2

Sujet: C5ORF4 is involved in the fatty acid biosynthetic process.

Poids moléculaire: 21 kDa (MW of target protein)