C5ORF4 anticorps (N-Term)
-
- Antigène Tous les produits C5ORF4 (FAXDC2)
- C5ORF4 (FAXDC2) (Fatty Acid Hydroxylase Domain Containing 2 (FAXDC2))
-
Épitope
- N-Term
-
Reactivité
- Humain, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp C5ORF4 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificité
- C5 ORF4 antibody was raised against the N terminal Of C5 rf4
- Purification
- Affinity purified
- Immunogène
- C5 ORF4 antibody was raised using the N terminal Of C5 rf4 corresponding to a region with amino acids MKGEAGHMLHNEKSKQEGHIWGSMRRTAFILGSGLLSFVAFWNSVTWHLQ
-
-
- Indications d'application
-
WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
C5ORF4 Blocking Peptide, catalog no. 33R-6138, is also available for use as a blocking control in assays to test for specificity of this C5ORF4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- C5ORF4 (FAXDC2) (Fatty Acid Hydroxylase Domain Containing 2 (FAXDC2))
- Autre désignation
- C5ORF4 (FAXDC2 Produits)
- Synonymes
- anticorps C5orf4, anticorps fatty acid hydroxylase domain containing 2, anticorps FAXDC2
- Sujet
- C5ORF4 is involved in the fatty acid biosynthetic process.
- Poids moléculaire
- 21 kDa (MW of target protein)
-