DENND1B anticorps (N-Term)
-
- Antigène Voir toutes DENND1B Anticorps
- DENND1B (DENN/MADD Domain Containing 1B (DENND1B))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp DENND1B est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- DENND1 B antibody was raised against the N terminal of DENND1
- Purification
- Affinity purified
- Immunogène
- DENND1 B antibody was raised using the N terminal of DENND1 corresponding to a region with amino acids YKLLNTLADYLAKELENDLNETLRSLYNHPVPKANTPVNLSVNQEIFIAC
- Top Product
- Discover our top product DENND1B Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
DENND1B Blocking Peptide, catalog no. 33R-10151, is also available for use as a blocking control in assays to test for specificity of this DENND1B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DENND0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- DENND1B (DENN/MADD Domain Containing 1B (DENND1B))
- Autre désignation
- DENND1B (DENND1B Produits)
- Synonymes
- anticorps C1ORF18, anticorps C1orf218, anticorps FAM31B, anticorps 4632404N19Rik, anticorps 4930467M19Rik, anticorps 6820401H01Rik, anticorps F730008N07Rik, anticorps Fam31b, anticorps si:ch211-195i21.1, anticorps DENN domain containing 1B, anticorps DENN/MADD domain containing 1B, anticorps DENND1B, anticorps dennd1b, anticorps Dennd1b
- Sujet
- DENND1B contains 1 dDENN domain, 1 DENN domain and 1 uDENN domain. The function of the DENND1B protein remains unknown.
- Poids moléculaire
- 45 kDa (MW of target protein)
-