STOML3 anticorps
-
- Antigène Tous les produits STOML3
- STOML3 (Stomatin (EPB72)-Like 3 (STOML3))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp STOML3 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- STOML3 antibody was raised using a synthetic peptide corresponding to a region with amino acids SFLLVIITFPISIWMCLKIIKEYERAVVFRLGRIQADKAKGPGLILVLPC
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
STOML3 Blocking Peptide, catalog no. 33R-8431, is also available for use as a blocking control in assays to test for specificity of this STOML3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STOML3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- STOML3 (Stomatin (EPB72)-Like 3 (STOML3))
- Autre désignation
- STOML3 (STOML3 Produits)
- Synonymes
- anticorps Epb7.2l, anticorps SLP3, anticorps sro, anticorps SRO, anticorps zgc:110200, anticorps stoml3, anticorps zgc:165564, anticorps stomatin (Epb7.2)-like 3, anticorps stomatin like 3, anticorps stomatin (EPB72)-like 3b, anticorps stomatin like 3 L homeolog, anticorps stomatin (EPB72)-like 3a, anticorps Stoml3, anticorps STOML3, anticorps stoml3b, anticorps stoml3.L, anticorps stoml3a
- Sujet
- The function of STOML3 protein is not widely studied, and is yet to be elucidated fully.
- Poids moléculaire
- 32 kDa (MW of target protein)
-