STOML3 anticorps

N° du produit ABIN635649

Détail du produit anti-STOML3 anticorps

Antigène: STOML3 (Stomatin (EPB72)-Like 3 (STOML3))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp STOML3 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: STOML3 antibody was raised using a synthetic peptide corresponding to a region with amino acids SFLLVIITFPISIWMCLKIIKEYERAVVFRLGRIQADKAKGPGLILVLPC

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

STOML3 Blocking Peptide, catalog no. 33R-8431, is also available for use as a blocking control in assays to test for specificity of this STOML3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STOML3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur STOML3

Antigène: STOML3 (Stomatin (EPB72)-Like 3 (STOML3))

Autre désignation: STOML3 (STOML3 Produits)

Synonymes: anticorps Epb7.2l, anticorps SLP3, anticorps sro, anticorps SRO, anticorps zgc:110200, anticorps stoml3, anticorps zgc:165564, anticorps stomatin (Epb7.2)-like 3, anticorps stomatin like 3, anticorps stomatin (EPB72)-like 3b, anticorps stomatin like 3 L homeolog, anticorps stomatin (EPB72)-like 3a, anticorps Stoml3, anticorps STOML3, anticorps stoml3b, anticorps stoml3.L, anticorps stoml3a

Sujet: The function of STOML3 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 32 kDa (MW of target protein)