TMEM161B anticorps (N-Term)

N° du produit ABIN635653

Détail du produit anti-TMEM161B anticorps

Antigène: TMEM161B (Transmembrane Protein 161B (TMEM161B))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TMEM161B est non-conjugé

Application: Western Blotting (WB)

Specificité: TMEM161 B antibody was raised against the N terminal of TMEM161

Purification: Affinity purified

Immunogène: TMEM161 B antibody was raised using the N terminal of TMEM161 corresponding to a region with amino acids GSLRWYQHPTEEELRILAGKQQKGKTKKDRKYNGHIESKPLTIPKDIDLH

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TMEM161B Blocking Peptide, catalog no. 33R-3573, is also available for use as a blocking control in assays to test for specificity of this TMEM161B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM160 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TMEM161B

Antigène: TMEM161B (Transmembrane Protein 161B (TMEM161B))

Autre désignation: TMEM161B (TMEM161B Produits)

Synonymes: anticorps FLB3342, anticorps PRO1313, anticorps 2810446P07Rik, anticorps AI843389, anticorps RGD1309660, anticorps id:ibd2207, anticorps wu:fc31d04, anticorps zgc:63626, anticorps transmembrane protein 161B, anticorps TMEM161B, anticorps Tmem161b, anticorps tmem161b

Sujet: The function of TMEM161 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 55 kDa (MW of target protein)