DPY19L2 anticorps
-
- Antigène Voir toutes DPY19L2 Anticorps
- DPY19L2 (Dpy-19-Like 2 (DPY19L2))
-
Reactivité
- Humain, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp DPY19L2 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- DPY19 L2 antibody was raised using a synthetic peptide corresponding to a region with amino acids IIGEFNNLPQEELLQWIKYSTTSDAVFAGAMPTMASIKLSTLHPIVNHPH
- Top Product
- Discover our top product DPY19L2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
DPY19L2 Blocking Peptide, catalog no. 33R-3998, is also available for use as a blocking control in assays to test for specificity of this DPY19L2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DPY10 2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- DPY19L2 (Dpy-19-Like 2 (DPY19L2))
- Autre désignation
- DPY19L2 (DPY19L2 Produits)
- Sujet
- The function of DPY19L2 has not been widely studied, and is yet to be fully elucidated.
- Poids moléculaire
- 87 kDa (MW of target protein)
-