DPY19L2 anticorps

N° du produit ABIN635657

Détail du produit anti-DPY19L2 anticorps

Antigène: DPY19L2 (Dpy-19-Like 2 (DPY19L2))

Reactivité: Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DPY19L2 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: DPY19 L2 antibody was raised using a synthetic peptide corresponding to a region with amino acids IIGEFNNLPQEELLQWIKYSTTSDAVFAGAMPTMASIKLSTLHPIVNHPH

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DPY19L2 Blocking Peptide, catalog no. 33R-3998, is also available for use as a blocking control in assays to test for specificity of this DPY19L2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DPY10 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DPY19L2

Antigène: DPY19L2 (Dpy-19-Like 2 (DPY19L2))

Autre désignation: DPY19L2 (DPY19L2 Produits)

Synonymes: anticorps SPATA34, anticorps SPGF9, anticorps Dyp19l2, anticorps RGD1564311, anticorps 4932443J21Rik, anticorps Gm18376, anticorps DPY19L2, anticorps dpy-19 like 2, anticorps probable C-mannosyltransferase DPY19L2, anticorps dpy-19-like 2 (C. elegans), anticorps DPY19L2, anticorps LOC100460030, anticorps Dpy19l2

Sujet: The function of DPY19L2 has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 87 kDa (MW of target protein)