HSD3B1 anticorps (N-Term)

N° du produit ABIN635665

Détail du produit anti-HSD3B1 anticorps

Antigène: HSD3B1 (Hydroxy-delta-5-Steroid Dehydrogenase, 3 beta- and Steroid delta-Isomerase 1 (HSD3B1))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HSD3B1 est non-conjugé

Application: Western Blotting (WB)

Specificité: HSD3 B1 antibody was raised against the N terminal of HSD3 1

Purification: Affinity purified

Immunogène: HSD3 B1 antibody was raised using the N terminal of HSD3 1 corresponding to a region with amino acids TGWSCLVTGAGGFLGQRIIRLLVKEKELKEIRVLDKAFGPELREEFSKLQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HSD3B1 Blocking Peptide, catalog no. 33R-9099, is also available for use as a blocking control in assays to test for specificity of this HSD3B1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HSD0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HSD3B1

Antigène: HSD3B1 (Hydroxy-delta-5-Steroid Dehydrogenase, 3 beta- and Steroid delta-Isomerase 1 (HSD3B1))

Autre désignation: HSD3B1 (HSD3B1 Produits)

Synonymes: anticorps 3BETAHSD, anticorps HSD3B, anticorps HSDB3, anticorps HSDB3A, anticorps I, anticorps SDR11E1, anticorps HSD3B1, anticorps MGC131206, anticorps D3Ertd383e, anticorps 3B-HSD, anticorps 3BHSD, anticorps si:rp71-68n21.10, anticorps hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 1, anticorps 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 1, anticorps hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 1 L homeolog, anticorps HSD3B1, anticorps LOC469446, anticorps LOC713091, anticorps hsd3b1.L, anticorps LOC100451655, anticorps Hsd3b1, anticorps hsd3b1

Sujet: 3-beta-HSD is a bifunctional enzyme, that catalyzes the oxidative conversion of Delta(5)-ene-3-beta-hydroxy steroid, and the oxidative conversion of ketosteroids. The 3-beta-HSD enzymatic system plays a crucial role in the biosynthesis of all classes of hormonal steroids.

Poids moléculaire: 42 kDa (MW of target protein)

Pathways: Metabolism of Steroid Hormones and Vitamin D, Steroid Hormone Biosynthesis, C21-Steroid Hormone Metabolic Process, Carbohydrate Homeostasis