P2RY12 anticorps (N-Term)

N° du produit ABIN635667

Détail du produit anti-P2RY12 anticorps

Antigène: P2RY12 (Purinergic Receptor P2Y, G-Protein Coupled, 12 (P2RY12))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp P2RY12 est non-conjugé

Application: Western Blotting (WB)

Specificité: P2 RY12 antibody was raised against the N terminal of P2 Y12

Purification: Affinity purified

Immunogène: P2 RY12 antibody was raised using the N terminal of P2 Y12 corresponding to a region with amino acids VAIWMFVFHMKPWSGISVYMFNLALADFLYVLTLPALIFYYFNKTDWIFG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

P2RY12 Blocking Peptide, catalog no. 33R-9419, is also available for use as a blocking control in assays to test for specificity of this P2RY12 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of P0 Y12 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur P2RY12

Antigène: P2RY12 (Purinergic Receptor P2Y, G-Protein Coupled, 12 (P2RY12))

Autre désignation: P2RY12 (P2RY12 Produits)

Synonymes: anticorps 2900079B22Rik, anticorps 4921504D23Rik, anticorps P2Y12, anticorps ADPG-R, anticorps BDPLT8, anticorps HORK3, anticorps P2T(AC), anticorps P2Y(12)R, anticorps P2Y(AC), anticorps P2Y(ADP), anticorps P2Y(cyc), anticorps SP1999, anticorps P2y12, anticorps purinergic receptor P2Y, G-protein coupled 12, anticorps purinergic receptor P2Y12, anticorps P2ry12, anticorps P2RY12

Sujet: P2RY12 belongs to the family of G-protein coupled receptors. This family has several receptor subtypes with different pharmacological selectivity, which overlaps in some cases, for various adenosine and uridine nucleotides. This receptor is involved in platelets aggregation, and is a potential target for the treatment of thromboembolisms and other clotting disorders.

Poids moléculaire: 39 kDa (MW of target protein)