TMEM63B anticorps (Middle Region)
-
- Antigène Tous les produits TMEM63B
- TMEM63B (Transmembrane Protein 63B (TMEM63B))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp TMEM63B est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- TMEM63 B antibody was raised against the middle region of TMEM63
- Purification
- Affinity purified
- Immunogène
- TMEM63 B antibody was raised using the middle region of TMEM63 corresponding to a region with amino acids VRGCEQVEAIEYYTKLEQKLKEDYKREKEKVNEKPLGMAFVTFHNETITA
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
TMEM63B Blocking Peptide, catalog no. 33R-9772, is also available for use as a blocking control in assays to test for specificity of this TMEM63B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM60 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- TMEM63B (Transmembrane Protein 63B (TMEM63B))
- Autre désignation
- TMEM63B (TMEM63B Produits)
- Synonymes
- anticorps C6orf110, anticorps RP3-421H19.2, anticorps BC026370, anticorps RGD1305862, anticorps Tmem63b-ps1, anticorps transmembrane protein 63B, anticorps transmembrane protein 63b, anticorps TMEM63B, anticorps Tmem63b
- Sujet
- TMEM63B belongs to the SPO75/TMEM63 family. It is a multi-pass membrane protein. The function of TMEM63B remains unknown.
- Poids moléculaire
- 95 kDa (MW of target protein)
-