PIGF anticorps (N-Term)

N° du produit ABIN635684

Détail du produit anti-PIGF anticorps

Antigène: PIGF (Phosphatidylinositol Glycan F (PIGF))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PIGF est non-conjugé

Application: Western Blotting (WB)

Specificité: PIGF antibody was raised against the N terminal of PIGF

Purification: Affinity purified

Immunogène: PIGF antibody was raised using the N terminal of PIGF corresponding to a region with amino acids MKDNDIKRLLYTHLLCIFSIILSVFIPSLFLENFSILETHLTWLCICSGF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PIGF Blocking Peptide, catalog no. 33R-6128, is also available for use as a blocking control in assays to test for specificity of this PIGF antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIGF antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PIGF

Antigène: PIGF (Phosphatidylinositol Glycan F (PIGF))

Autre désignation: PIGF (PIGF Produits)

Synonymes: anticorps pigf, anticorps zgc:77184, anticorps phosphatidylinositol glycan anchor biosynthesis class F, anticorps phosphatidylinositol glycan anchor biosynthesis, class F, anticorps phosphatidylinositol glycan anchor biosynthesis class F S homeolog, anticorps PIGF, anticorps Pigf, anticorps pigf.S, anticorps pigf

Sujet: PIGF is a protein involved in glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI-anchor, a glycolipid containing three mannose molecules in its core backbone, is found on many blood cells where it serves to anchor proteins to the cell surface. PIGF and another GPI synthesis protein, PIGO, function in the transfer of ethanolaminephosphate to the third mannose in GPI.

Poids moléculaire: 25 kDa (MW of target protein)

Pathways: Inositol Metabolic Process