IgK anticorps (N-Term)
-
- Antigène Tous les produits IgK
- IgK (Immunoglobulin kappa (IgK))
- Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp IgK est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- PIGK antibody was raised against the N terminal of PIGK
- Purification
- Affinity purified
- Immunogène
- PIGK antibody was raised using the N terminal of PIGK corresponding to a region with amino acids SVYRSVKRLGIPDSHIVLMLADDMACNPRNPKPATVFSHKNMELNVYGDD
-
-
- Indications d'application
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PIGK Blocking Peptide, catalog no. 33R-8936, is also available for use as a blocking control in assays to test for specificity of this PIGK antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIGK antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- IgK (Immunoglobulin kappa (IgK))
- Autre désignation
- IGK (IgK Produits)
- Synonymes
- anticorps IGK@, anticorps immunoglobulin kappa locus, anticorps IGK
- Sujet
- PIGK is a member of the cysteine protease family C13 that is involved in glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI-anchor is a glycolipid found on many blood cells and serves to anchor proteins to the cell surface. PIGK is a member of the multisubunit enzyme, GPI transamidase and is thought to be its enzymatic component. GPI transamidase mediates GPI anchoring in the endoplasmic reticulum, by catalyzing the transfer of fully assembled GPI units to proteins.
- Poids moléculaire
- 43 kDa (MW of target protein)
-