IgK anticorps (N-Term)

N° du produit ABIN635686

Détail du produit anti-IgK anticorps

Antigène: IgK (Immunoglobulin kappa (IgK))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp IgK est non-conjugé

Application: Western Blotting (WB)

Specificité: PIGK antibody was raised against the N terminal of PIGK

Purification: Affinity purified

Immunogène: PIGK antibody was raised using the N terminal of PIGK corresponding to a region with amino acids MAVTDSLSRAATVLATVLLLSFGSVAASHIEDQAEQFFRSGHTNNWAVLV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PIGK Blocking Peptide, catalog no. 33R-5803, is also available for use as a blocking control in assays to test for specificity of this PIGK antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIGK antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur IgK

Antigène: IgK (Immunoglobulin kappa (IgK))

Autre désignation: IGK (IgK Produits)

Synonymes: anticorps IGK@, anticorps immunoglobulin kappa locus, anticorps IGK

Sujet: PIGK is a member of the cysteine protease family C13 that is involved in glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI-anchor is a glycolipid found on many blood cells and serves to anchor proteins to the cell surface. PIGK is a member of the multisubunit enzyme, GPI transamidase and is thought to be its enzymatic component. GPI transamidase mediates GPI anchoring in the endoplasmic reticulum, by catalyzing the transfer of fully assembled GPI units to proteins.

Poids moléculaire: 43 kDa (MW of target protein)