CLN8 anticorps

N° du produit ABIN635687

Détail du produit anti-CLN8 anticorps

Antigène: CLN8 (Ceroid-Lipofuscinosis, Neuronal 8 (Epilepsy, Progressive with Mental Retardation) (CLN8))

Reactivité: Humain, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CLN8 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: CLN8 antibody was raised using a synthetic peptide corresponding to a region with amino acids MNPASDGGTSESIFDLDYASWGIRSTLMVAGFVFYLGVFVVCHQLSSSLN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CLN8 Blocking Peptide, catalog no. 33R-6257, is also available for use as a blocking control in assays to test for specificity of this CLN8 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLN8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CLN8

Antigène: CLN8 (Ceroid-Lipofuscinosis, Neuronal 8 (Epilepsy, Progressive with Mental Retardation) (CLN8))

Autre désignation: CLN8 (CLN8 Produits)

Synonymes: anticorps mnd, anticorps C8orf61, anticorps EPMR, anticorps CLN8, transmembrane ER and ERGIC protein, anticorps ceroid-lipofuscinosis, neuronal 8, anticorps CLN8, anticorps Cln8

Sujet: CLN8 is a transmembrane protein belonging to a family of proteins containing TLC domains, which are postulated to function in lipid synthesis, transport, or sensing. The protein localizes to the endoplasmic reticulum (ER), and may recycle between the ER and ER-Golgi intermediate compartment.

Poids moléculaire: 33 kDa (MW of target protein)

Pathways: Regulation of Cell Size, Dicarboxylic Acid Transport