ALDH3A2 anticorps (C-Term)

N° du produit ABIN635691

Détail du produit anti-ALDH3A2 anticorps

Antigène: ALDH3A2 (Aldehyde Dehydrogenase 3 Family, Member A2 (ALDH3A2))

Épitope: C-Term

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ALDH3A2 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: ALDH3 A2 antibody was raised against the C terminal of ALDH3 2

Purification: Affinity purified

Immunogène: ALDH3 A2 antibody was raised using the C terminal of ALDH3 2 corresponding to a region with amino acids FINEREKPLALYVFSHNHKLIKRMIDETSSGGVTGNDVIMHFTLNSFPFG

Information d'application

Indications d'application: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ALDH3A2 Blocking Peptide, catalog no. 33R-2933, is also available for use as a blocking control in assays to test for specificity of this ALDH3A2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALDH0 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ALDH3A2

Antigène: ALDH3A2 (Aldehyde Dehydrogenase 3 Family, Member A2 (ALDH3A2))

Autre désignation: ALDH3A2 (ALDH3A2 Produits)

Synonymes: anticorps ALDH10, anticorps FALDH, anticorps SLS, anticorps AI194803, anticorps Ahd-3, anticorps Ahd-3r, anticorps Ahd3, anticorps Ahd3-r, anticorps Aldh4, anticorps Aldh4-r, anticorps ALDH-III, anticorps CG11140, anticorps CT41571, anticorps Dhap, anticorps Dmel\\CG11140, anticorps l(2)03610, anticorps Aldh-III, anticorps aldh3a2, anticorps wu:fc06b11, anticorps zgc:92064, anticorps ALDH3A2, anticorps aldehyde dehydrogenase 3 family member A2, anticorps aldehyde dehydrogenase family 3, subfamily A2, anticorps aldehyde dehydrogenase 3 family, member A2, anticorps Aldehyde dehydrogenase type III, anticorps fatty aldehyde dehydrogenase, anticorps aldehyde dehydrogenase 3 family, member A2a, anticorps aldehyde dehydrogenase 3 family member A2 S homeolog, anticorps aldH, anticorps ALDH3A2, anticorps Aldh3a2, anticorps Aldh-III, anticorps PTRG_02589, anticorps aldh3a2, anticorps aldh3a2a, anticorps aldh3a2.S, anticorps aldH

Sujet: Aldehyde dehydrogenase isozymes are thought to play a major role in the detoxification of aldehydes generated by alcohol metabolism and lipid peroxidation. This gene product catalyzes the oxidation of long-chain aliphatic aldehydes to fatty acid. Mutations in the gene cause Sjogren-Larsson syndrome.

Poids moléculaire: 53 kDa (MW of target protein)