SMPD1 anticorps (Middle Region)
-
- Antigène Voir toutes SMPD1 Anticorps
- SMPD1 (Sphingomyelin phosphodiesterase 1, Acid Lysosomal (SMPD1))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SMPD1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- SMPD1 antibody was raised against the middle region of SMPD1
- Purification
- Affinity purified
- Immunogène
- SMPD1 antibody was raised using the middle region of SMPD1 corresponding to a region with amino acids INSTDPAGQLQWLVGELQAAEDRGDKVHIIGHIPPGHCLKSWSWNYYRIV
- Top Product
- Discover our top product SMPD1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SMPD1 Blocking Peptide, catalog no. 33R-4082, is also available for use as a blocking control in assays to test for specificity of this SMPD1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SMPD1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SMPD1 (Sphingomyelin phosphodiesterase 1, Acid Lysosomal (SMPD1))
- Autre désignation
- SMPD1 (SMPD1 Produits)
- Synonymes
- anticorps ASM, anticorps ASMASE, anticorps NPD, anticorps A-SMase, anticorps Zn-SMase, anticorps aSMase, anticorps SMPD1, anticorps sphingomyelin phosphodiesterase 1, anticorps sphingomyelin phosphodiesterase 1, acid lysosomal, anticorps sphingomyelin phosphodiesterase, anticorps SMPD1, anticorps Smpd1, anticorps LOC5578088
- Sujet
- SMPD1 is a lysosomal acid sphingomyelinase that converts sphingomyelin to ceramide. The encoded protein also has phospholipase C activity. Defects in this gene are a cause of Niemann-Pick disease type A (NPA) and Niemann-Pick disease type B (NPB).
- Poids moléculaire
- 65 kDa (MW of target protein)
-