DLL3 anticorps
-
- Antigène Voir toutes DLL3 Anticorps
- DLL3 (delta Like Protein 3 (DLL3))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp DLL3 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- DLL3 antibody was raised using a synthetic peptide corresponding to a region with amino acids MVSPRMSGLLSQTVILALIFLPQTRPAGVFELQIHSFGPGPGPGAPRSPC
- Top Product
- Discover our top product DLL3 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
DLL3 Blocking Peptide, catalog no. 33R-6609, is also available for use as a blocking control in assays to test for specificity of this DLL3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DLL3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- DLL3 (delta Like Protein 3 (DLL3))
- Autre désignation
- DLL3 (DLL3 Produits)
- Synonymes
- anticorps SCDO1, anticorps pu, anticorps pudgy, anticorps delta like canonical Notch ligand 3, anticorps delta-like 3 (Drosophila), anticorps DLL3, anticorps Dll3
- Sujet
- DLL3 is a member of the delta protein ligand family. This family functions as Notch ligands that are characterized by a DSL domain, EGF repeats, and a transmembrane domain. Mutations in this gene cause autosomal recessive spondylocostal dysostosis 1.
- Poids moléculaire
- 54 kDa (MW of target protein)
- Pathways
- Signalisation Notch
-