NTRK3 anticorps (C-Term)
-
- Antigène Voir toutes NTRK3 Anticorps
- NTRK3 (Neurotrophic tyrosine Kinase, Receptor, Type 3 (NTRK3))
-
Épitope
- C-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp NTRK3 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- NTRK3 antibody was raised against the C terminal of NTRK3
- Purification
- Affinity purified
- Immunogène
- NTRK3 antibody was raised using the C terminal of NTRK3 corresponding to a region with amino acids ERPRVCPKEVYDVMLGCWQREPQQRLNIKEIYKILHALGKATPIYLDILG
- Top Product
- Discover our top product NTRK3 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
NTRK3 Blocking Peptide, catalog no. 33R-2709, is also available for use as a blocking control in assays to test for specificity of this NTRK3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NTRK3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- NTRK3 (Neurotrophic tyrosine Kinase, Receptor, Type 3 (NTRK3))
- Autre désignation
- NTRK3 (NTRK3 Produits)
- Synonymes
- anticorps TRKC, anticorps gp145(trkC), anticorps trkC, anticorps AW125844, anticorps Ntrk3_tv3, anticorps TrkC, anticorps neurotrophic receptor tyrosine kinase 3, anticorps neurotrophic tyrosine kinase, receptor, type 3, anticorps NTRK3, anticorps Ntrk3
- Sujet
- NTRK3 is a member of the neurotrophic tyrosine receptor kinase (NTRK) family. This kinase is a membrane-bound receptor that, upon neurotrophin binding, phosphorylates itself and members of the MAPK pathway. Signalling through this kinase leads to cell differentiation and may play a role in the development of proprioceptive neurons that sense body position. Mutations in this gene have been associated with medulloblastomas, secretory breast carcinomas and other cancers.
- Poids moléculaire
- 89 kDa (MW of target protein)
- Pathways
- Signalisation RTK, Neurotrophin Signaling Pathway, Regulation of Cell Size
-