Sonic Hedgehog anticorps

N° du produit ABIN635696

Détail du produit anti-Sonic Hedgehog anticorps

Antigène: Sonic Hedgehog (SHH)

Reactivité: Humain, Souris, Poisson zèbre (Danio rerio), Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Sonic Hedgehog est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Purification: Affinity purified

Immunogène: Sonic Hedgehog antibody was raised using a synthetic peptide corresponding to a region with amino acids RCLLLVLVSSLLVCSGLACGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKT

Information d'application

Indications d'application: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Sonic Hedgehog Blocking Peptide, catalog no. 33R-7837, is also available for use as a blocking control in assays to test for specificity of this Sonic Hedgehog antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SHH antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Sonic Hedgehog

Antigène: Sonic Hedgehog (SHH)

Autre désignation: Sonic Hedgehog (SHH Produits)

Synonymes: anticorps HHG1, anticorps HLP3, anticorps HPE3, anticorps MCOPCB5, anticorps SMMCI, anticorps TPT, anticorps TPTPS, anticorps 9530036O11Rik, anticorps Dsh, anticorps Hhg1, anticorps Hx, anticorps Hxl3, anticorps M100081, anticorps fc83d08, anticorps shh, anticorps syu, anticorps vhh-1, anticorps vhh1, anticorps wu:fc83d08, anticorps Xhh, anticorps hedgehog, anticorps xshh, anticorps SHH, anticorps twh, anticorps twhh, anticorps sonic hedgehog, anticorps sonic hedgehog a, anticorps sonic hedgehog L homeolog, anticorps sonic hedgehog protein A, anticorps sonic hedgehog b, anticorps SHH, anticorps Shh, anticorps shha, anticorps shh.L, anticorps shh, anticorps shhb

Sujet: SHH is a protein that is instrumental in patterning the early embryo. It has been implicated as the key inductive signal in patterning of the ventral neural tube, the anterior-posterior limb axis, and the ventral somites. Defects in this protein or in its signalling pathway are a cause of holoprosencephaly (HPE). It is also thought that mutations in its gene or in its signalling pathway may be responsible for VACTERL syndrome, which is characterized by vertebral defects, anal atresia, tracheoesophageal fistula with esophageal atresia, radial and renal dysplasia, cardiac anomalies, and limb abnormalities.

Poids moléculaire: 28 kDa (MW of target protein)

Pathways: Signalisation Hedgehog, Dopaminergic Neurogenesis, Regulation of Muscle Cell Differentiation, Tube Formation, Skeletal Muscle Fiber Development