ST8SIA2 anticorps (C-Term)

N° du produit ABIN635706

Détail du produit anti-ST8SIA2 anticorps

Antigène: ST8SIA2 (ST8 alpha-N-Acetyl-Neuraminide alpha-2,8-Sialyltransferase 2 (ST8SIA2))

Épitope: C-Term

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ST8SIA2 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: ST8 SIA2 antibody was raised against the C terminal of ST8 IA2

Purification: Affinity purified

Immunogène: ST8 SIA2 antibody was raised using the C terminal of ST8 IA2 corresponding to a region with amino acids TGLLMYTLATRFCKQIYLYGFWPFPLDQNQNPVKYHYYDSLKYGYTSQAS

Information d'application

Indications d'application: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ST8SIA2 Blocking Peptide, catalog no. 33R-9089, is also available for use as a blocking control in assays to test for specificity of this ST8SIA2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ST0 IA2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ST8SIA2

Antigène: ST8SIA2 (ST8 alpha-N-Acetyl-Neuraminide alpha-2,8-Sialyltransferase 2 (ST8SIA2))

Autre désignation: ST8SIA2 (ST8SIA2 Produits)

Synonymes: anticorps cb394, anticorps id:ibd5161, anticorps siat8, anticorps SIAT8B, anticorps HsT19690, anticorps ST8SIA-II, anticorps STX, anticorps SIAT 8B, anticorps AI323367, anticorps ST8SiaII, anticorps Siat8b, anticorps ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 2, anticorps ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 2 L homeolog, anticorps st8sia2, anticorps st8sia2.L, anticorps ST8SIA2, anticorps St8sia2

Sujet: ST8SIA2 is a type II membrane protein that is thought to catalyze the transfer of sialic acid from CMP-sialic acid to N-linked oligosaccharides and glycoproteins. ST8SIA2 may be found in the Golgi apparatus and may be involved in the production of polysialic acid, a modulator of the adhesive properties of neural cell adhesion molecule (NCAM1). This protein is a member of glycosyltransferase family 29.

Poids moléculaire: 42 kDa (MW of target protein)