MTCH1 anticorps

N° du produit ABIN635711

Détail du produit anti-MTCH1 anticorps

Antigène: MTCH1 (Mitochondrial Carrier 1 (MTCH1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MTCH1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: MTCH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids NNCGLQAGLPPYSPVFKSWIHCWKYLSVQGQLFRGSSLLFRRVSSGSCFA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MTCH1 Blocking Peptide, catalog no. 33R-6803, is also available for use as a blocking control in assays to test for specificity of this MTCH1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MTCH1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MTCH1

Antigène: MTCH1 (Mitochondrial Carrier 1 (MTCH1))

Autre désignation: MTCH1 (MTCH1 Produits)

Synonymes: anticorps CGI-64, anticorps PIG60, anticorps PSAP, anticorps SLC25A49, anticorps 2310034O17Rik, anticorps AI255158, anticorps AU018396, anticorps C77849, anticorps MTCH1, anticorps mitochondrial carrier 1, anticorps MTCH1, anticorps Mtch1

Sujet: MTCH1 is a potential mitochondrial transporter. It may play a role in apoptosis.

Poids moléculaire: 40 kDa (MW of target protein)

Pathways: Positive Regulation of Endopeptidase Activity, SARS-CoV-2 Protein Interactome