Netrin 4 anticorps (N-Term)

N° du produit ABIN635714

Détail du produit anti-Netrin 4 anticorps

Antigène: Netrin 4 (NTN4)

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Netrin 4 est non-conjugé

Application: Western Blotting (WB)

Specificité: Netrin 4 antibody was raised against the N terminal of NTN4

Purification: Affinity purified

Immunogène: Netrin 4 antibody was raised using the N terminal of NTN4 corresponding to a region with amino acids EDVHREKIQLDLEAEFYFTHLIVMFKSPRPAAMVLDRSQDFGKTWKPYKY

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Netrin 4 Blocking Peptide, catalog no. 33R-2330, is also available for use as a blocking control in assays to test for specificity of this Netrin 4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NTN4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Netrin 4

Antigène: Netrin 4 (NTN4)

Autre désignation: Netrin 4 (NTN4 Produits)

Synonymes: anticorps Netrin-4, anticorps PRO3091, anticorps RGD1565947, anticorps netrin 4, anticorps netrin-4, anticorps NTN4, anticorps ntn4, anticorps Ntn4, anticorps LOC100541214

Sujet: NTN4 contains 3 laminin EGF-like domains, 1 laminin N-terminal domain and 1 NTR domain. NTN4 may play an important role in neural, kidney and vascular development. It promotes neurite elongation from olfactory bulb explants.

Poids moléculaire: 70 kDa (MW of target protein)