GAA anticorps (N-Term)
-
- Antigène Voir toutes GAA Anticorps
- GAA (Glucosidase, Alpha, Acid (GAA))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp GAA est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- GAA antibody was raised against the N terminal of GAA
- Purification
- Affinity purified
- Immunogène
- GAA antibody was raised using the N terminal of GAA corresponding to a region with amino acids FGVIVRRQLDGRVLLNTTVAPLFFADQFLQLSTSLPSQYITGLAEHLSPL
- Top Product
- Discover our top product GAA Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
GAA Blocking Peptide, catalog no. 33R-2917, is also available for use as a blocking control in assays to test for specificity of this GAA antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GAA antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- GAA (Glucosidase, Alpha, Acid (GAA))
- Autre désignation
- GAA (GAA Produits)
- Synonymes
- anticorps LYAG, anticorps E430018M07Rik, anticorps glucosidase alpha, acid, anticorps glucosidase, alpha, acid, anticorps transmembrane and coiled-coil domain family 1, anticorps glucosidase, alpha; acid (Pompe disease, glycogen storage disease type II), anticorps GAA, anticorps Gaa, anticorps TMCC1, anticorps gaa
- Sujet
- GAA is acid alpha-glucosidase, which is essential for the degradation of glycogen to glucose in lysosomes. Different forms of acid alpha-glucosidase are obtained by proteolytic processing. Defects in this gene are the cause of glycogen storage disease II, also known as Pompe's disease, which is an autosomal recessive disorder with a broad clinical spectrum.
- Poids moléculaire
- 98 kDa (MW of target protein)
- Pathways
- Cellular Glucan Metabolic Process
-