ABCA12 anticorps

N° du produit ABIN635729

Détail du produit anti-ABCA12 anticorps

Antigène: ABCA12 (ATP-Binding Cassette, Sub-Family A (ABC1), Member 12 (ABCA12))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ABCA12 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: ABCA12 antibody was raised using a synthetic peptide corresponding to a region with amino acids TTIFKMLTGDIIPSSGNILIRNKTGSLGHVDSHSSLVGYCPQEDALDDLV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ABCA12 Blocking Peptide, catalog no. 33R-9318, is also available for use as a blocking control in assays to test for specificity of this ABCA12 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABCA12 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ABCA12

Antigène: ABCA12 (ATP-Binding Cassette, Sub-Family A (ABC1), Member 12 (ABCA12))

Autre désignation: ABCA12 (ABCA12 Produits)

Synonymes: anticorps cb352, anticorps sb:cb352, anticorps ARCI4A, anticorps ARCI4B, anticorps ICR2B, anticorps LI2, anticorps 4832428G11Rik, anticorps 4833417A11Rik, anticorps ATP binding cassette subfamily A member 12, anticorps ATP-binding cassette, sub-family A (ABC1), member 12, anticorps ABCA12, anticorps abca12, anticorps Abca12

Sujet: The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intracellular membranes.

Poids moléculaire: 257 kDa (MW of target protein)