MPPE1 anticorps (N-Term)

N° du produit ABIN635730

Détail du produit anti-MPPE1 anticorps

Antigène: MPPE1 (Metallophosphoesterase 1 (MPPE1))

Épitope: N-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MPPE1 est non-conjugé

Application: Western Blotting (WB)

Specificité: MPPE1 antibody was raised against the N terminal of MPPE1

Purification: Affinity purified

Immunogène: MPPE1 antibody was raised using the N terminal of MPPE1 corresponding to a region with amino acids WLLQPEVVFILGDIFDEGKWSTPEAWADDVERFQKMFRHPSHVQLKVVAG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MPPE1 Blocking Peptide, catalog no. 33R-9972, is also available for use as a blocking control in assays to test for specificity of this MPPE1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MPPE1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MPPE1

Antigène: MPPE1 (Metallophosphoesterase 1 (MPPE1))

Autre désignation: MPPE1 (MPPE1 Produits)

Synonymes: anticorps zgc:112219, anticorps PGAP5, anticorps A530095G11, anticorps pgap5, anticorps MPPE1, anticorps metallophosphoesterase 1, anticorps metallophosphoesterase 1 L homeolog, anticorps MPPE1, anticorps mppe1, anticorps CpipJ_CPIJ008075, anticorps Bm1_07905, anticorps Tsp_09516, anticorps Mppe1, anticorps mppe1.L

Sujet: The specific function of MPPE1 is not yet known.

Poids moléculaire: 40 kDa (MW of target protein)

Pathways: Inositol Metabolic Process