LRFN3 anticorps (C-Term)
-
- Antigène Voir toutes LRFN3 Anticorps
- LRFN3 (Leucine Rich Repeat and Fibronectin Type III Domain Containing 3 (LRFN3))
-
Épitope
- C-Term
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp LRFN3 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- LRFN3 antibody was raised against the C terminal of LRFN3
- Purification
- Affinity purified
- Immunogène
- LRFN3 antibody was raised using the C terminal of LRFN3 corresponding to a region with amino acids VYRMIPAESRSFLLTDLASGRTYDLCVLAVYEDSATGLTATRPVGCARFS
- Top Product
- Discover our top product LRFN3 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
LRFN3 Blocking Peptide, catalog no. 33R-9926, is also available for use as a blocking control in assays to test for specificity of this LRFN3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRFN3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- LRFN3 (Leucine Rich Repeat and Fibronectin Type III Domain Containing 3 (LRFN3))
- Autre désignation
- LRFN3 (LRFN3 Produits)
- Synonymes
- anticorps FIGLER1, anticorps SALM4, anticorps A530045B06Rik, anticorps Salm4, anticorps LRFN3, anticorps leucine rich repeat and fibronectin type III domain containing 3, anticorps LRFN3, anticorps Lrfn3
- Sujet
- LRFN3 belongs to the LRFN family. Its exact function remains unknown.
- Poids moléculaire
- 66 kDa (MW of target protein)
- Pathways
- Synaptic Membrane
-