GAL3ST3 anticorps (C-Term)

N° du produit ABIN635734

Détail du produit anti-GAL3ST3 anticorps

Antigène: GAL3ST3 (Galactose-3-O-Sulfotransferase 3 (GAL3ST3))

Épitope: C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GAL3ST3 est non-conjugé

Application: Western Blotting (WB)

Specificité: GAL3 ST3 antibody was raised against the C terminal of GAL3 T3

Purification: Affinity purified

Immunogène: GAL3 ST3 antibody was raised using the C terminal of GAL3 T3 corresponding to a region with amino acids VDIMGYDLPGGGAGPATEACLKLAMPEVQYSNYLLRKQKRRGGARARPEP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GAL3ST3 Blocking Peptide, catalog no. 33R-9463, is also available for use as a blocking control in assays to test for specificity of this GAL3ST3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GAL0 T3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GAL3ST3

Antigène: GAL3ST3 (Galactose-3-O-Sulfotransferase 3 (GAL3ST3))

Autre désignation: GAL3ST3 (GAL3ST3 Produits)

Synonymes: anticorps GAL3ST-3, anticorps GAL3ST2, anticorps galactose-3-O-sulfotransferase 3, anticorps GAL3ST3, anticorps Gal3st3

Sujet: GAL3ST3 is a member of the galactose-3-O-sulfotransferase protein family. It catalyzes sulfonation by transferring a sulfate group to the 3' position of galactose in N-acetyllactosamine in both type 2 (Gal-beta-1-4GlcNAc-R) oligosaccharides and core-2-branched O-glycans, but not on type 1 or core-1-branched structures. This gene is different from the GAL3ST2 gene located on chromosome 2 that encodes a related enzyme with distinct tissue distribution and substrate specificities, compared to galactose-3-O-sulfotransferase 3.

Poids moléculaire: 49 kDa (MW of target protein)