GALC anticorps (Middle Region)

N° du produit ABIN635737

Détail du produit anti-GALC anticorps

Antigène: GALC (Galactosylceramidase (GALC))

Épitope: Middle Region

Reactivité: Humain, Rat, Souris, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GALC est non-conjugé

Application: Western Blotting (WB)

Specificité: GALC antibody was raised against the middle region of GALC

Purification: Affinity purified

Immunogène: GALC antibody was raised using the middle region of GALC corresponding to a region with amino acids LMTAQEPWSGHYVVESPVWVSAHTTQFTQPGWYYLKTVGHLEKGGSYVAL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GALC Blocking Peptide, catalog no. 33R-5213, is also available for use as a blocking control in assays to test for specificity of this GALC antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GALC antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GALC

Antigène: GALC (Galactosylceramidase (GALC))

Autre désignation: GALC (GALC Produits)

Synonymes: anticorps 2310068B06Rik, anticorps A930008M05Rik, anticorps AW212969, anticorps AW413532, anticorps Gacy, anticorps twi, anticorps twitcher, anticorps galc, anticorps galcl, anticorps zgc:92561, anticorps si:ch211-199l3.4, anticorps GALCERase, anticorps wu:fi04e07, anticorps zgc:56444, anticorps galactosylceramidase, anticorps galactosylceramidase a, anticorps Galactosylceramidase, anticorps galactosylceramidase L homeolog, anticorps galactosylceramidase b, anticorps GALC, anticorps Galc, anticorps galca, anticorps galc, anticorps Caci_7107, anticorps Bacsa_1415, anticorps Spico_0384, anticorps LOC100304802, anticorps galc.L, anticorps galcb

Sujet: GALC is a lysosomal protein which hydrolyzes the galactose ester bonds of galactosylceramide, galactosylsphingosine, lactosylceramide, and monogalactosyldiglyceride. Mutations in this gene have been associated with Krabbe disease, also known as globoid cell leukodystrophy.

Poids moléculaire: 73 kDa (MW of target protein)