SLC29A2 anticorps
-
- Antigène Voir toutes SLC29A2 Anticorps
- SLC29A2 (Solute Carrier Family 29 (Nucleoside Transporters), Member 2 (SLC29A2))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SLC29A2 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- SLC29 A2 antibody was raised using a synthetic peptide corresponding to a region with amino acids PLLVCLRFLFVPLFMLCHVPQRSRLPILFPQDAYFITFMLLFAVSNGYLV
- Top Product
- Discover our top product SLC29A2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SLC29A2 Blocking Peptide, catalog no. 33R-7199, is also available for use as a blocking control in assays to test for specificity of this SLC29A2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SLC29A2 (Solute Carrier Family 29 (Nucleoside Transporters), Member 2 (SLC29A2))
- Autre désignation
- SLC29A2 (SLC29A2 Produits)
- Synonymes
- anticorps DER12, anticorps ENT2, anticorps HNP36, anticorps Der12, anticorps Ent2, anticorps Hnp36, anticorps ent2, anticorps der12, anticorps hnp36, anticorps MGC82995, anticorps DKFZp468L038, anticorps zgc:110527, anticorps solute carrier family 29 member 2, anticorps solute carrier family 29 (nucleoside transporters), member 2, anticorps solute carrier family 29 (equilibrative nucleoside transporter), member 2 L homeolog, anticorps solute carrier family 29 (equilibrative nucleoside transporter), member 2, anticorps SLC29A2, anticorps Slc29a2, anticorps slc29a2.L, anticorps slc29a2
- Sujet
- SLC29A2 mediates equilibrative transport of purine, pyrimidine nucleosides and the purine base hypoxanthine. It is less sensitive than SLC29A1 to inhibition by nitrobenzylthioinosine (NBMPR), dipyridamole, dilazep and draflazine.
- Poids moléculaire
- 50 kDa (MW of target protein)
-