SLC35A5 anticorps (N-Term)

N° du produit ABIN635739

Détail du produit anti-SLC35A5 anticorps

Antigène: SLC35A5 (Solute Carrier Family 35, Member A5 (SLC35A5))

Épitope: N-Term

Reactivité: Souris, Rat, Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SLC35A5 est non-conjugé

Application: Western Blotting (WB)

Specificité: SLC35 A5 antibody was raised against the N terminal of SLC35 5

Purification: Affinity purified

Immunogène: SLC35 A5 antibody was raised using the N terminal of SLC35 5 corresponding to a region with amino acids LVKYSANEENKYDYLPTTVNVCSELVKLVFCVLVSFCVIKKDHQSRNLKY

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SLC35A5 Blocking Peptide, catalog no. 33R-5521, is also available for use as a blocking control in assays to test for specificity of this SLC35A5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SLC35A5

Antigène: SLC35A5 (Solute Carrier Family 35, Member A5 (SLC35A5))

Autre désignation: SLC35A5 (SLC35A5 Produits)

Synonymes: anticorps DKFZp459B2411, anticorps si:bz20i5.1, anticorps zgc:66231, anticorps 1010001J06Rik, anticorps AU021179, anticorps BB097433, anticorps D16Ertd450e, anticorps D730043G07Rik, anticorps RGD1564361, anticorps solute carrier family 35 member A5, anticorps solute carrier family 35, member A5, anticorps solute carrier family 35 member A5 S homeolog, anticorps SLC35A5, anticorps slc35a5, anticorps slc35a5.S, anticorps Slc35a5

Sujet: SLC35A5 belongs to the nucleotide-sugar transporter family, SLC35A subfamily. It is a multi-pass membrane protein. The function of the SLC35A5 protein remains unknown.

Poids moléculaire: 48 kDa (MW of target protein)