PAM anticorps (N-Term)

N° du produit ABIN635741

Détail du produit anti-PAM anticorps

Antigène: PAM (Peptidylglycine alpha-Amidating Monooxygenase (PAM))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PAM est non-conjugé

Application: Western Blotting (WB)

Specificité: PAM antibody was raised against the N terminal of PAM

Purification: Affinity purified

Immunogène: PAM antibody was raised using the N terminal of PAM corresponding to a region with amino acids PKGVGFRVGGETGSKYFVLQVHYGDISAFRDNNKDCSGVSLHLTRLPQPL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PAM Blocking Peptide, catalog no. 33R-7169, is also available for use as a blocking control in assays to test for specificity of this PAM antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PAM antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PAM

Antigène: PAM (Peptidylglycine alpha-Amidating Monooxygenase (PAM))

Autre désignation: PAM (PAM Produits)

Synonymes: anticorps PAL, anticorps PHM, anticorps pal, anticorps phm, anticorps pamb, anticorps CG3832, anticorps Dmel\\CG3832, anticorps dPHM, anticorps AE-I, anticorps PAL-A, anticorps PHM-A, anticorps pama, anticorps si:dkeyp-35f12.2, anticorps peptidylglycine alpha-amidating monooxygenase, anticorps peptidylglycine alpha-amidating monooxygenase S homeolog, anticorps Peptidylglycine-alpha-hydroxylating monooxygenase, anticorps peptidylglycine alpha-amidating monooxygenase L homeolog, anticorps PAM, anticorps Pam, anticorps pam.S, anticorps CHLREDRAFT_150435, anticorps sce7070, anticorps pam, anticorps Phm, anticorps pam.L

Sujet: PAM is a multifunctional protein. It has two enzymatically active domains with catalytic activities-peptidylglycine alpha-hydroxylating monooxygenase (PHM) and peptidyl-alpha-hydroxyglycine alpha-amidating lyase (PAL). These catalytic domains work sequentially to catalyze neuroendocrine peptides to active alpha-amidated products.

Poids moléculaire: 108 kDa (MW of target protein)