XYLT2 anticorps (Middle Region)

N° du produit ABIN635743

Détail du produit anti-XYLT2 anticorps

Antigène: XYLT2 (Xylosyltransferase II (XYLT2))

Épitope: Middle Region

Reactivité: Souris, Humain, Chien, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp XYLT2 est non-conjugé

Application: Western Blotting (WB)

Specificité: XYLT2 antibody was raised against the middle region of XYLT2

Purification: Affinity purified

Immunogène: XYLT2 antibody was raised using the middle region of XYLT2 corresponding to a region with amino acids PMGTPLCRFEPRGLPSSVHLYFYDDHFQGYLVTQAVQPSAQGPAETLEMW

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

XYLT2 Blocking Peptide, catalog no. 33R-7222, is also available for use as a blocking control in assays to test for specificity of this XYLT2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of XYLT2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur XYLT2

Antigène: XYLT2 (Xylosyltransferase II (XYLT2))

Autre désignation: XYLT2 (XYLT2 Produits)

Synonymes: anticorps MGC89331, anticorps PXYLT2, anticorps XT-II, anticorps XT2, anticorps xylT-II, anticorps xt-II, anticorps E030002B02Rik, anticorps xylt-II, anticorps xylosyltransferase II, anticorps xylosyltransferase 2, anticorps xylt2, anticorps XYLT2, anticorps Xylt2

Sujet: XYLT2 is an isoform of xylosyltransferase, which belongs to a family of glycosyltransferases.

Poids moléculaire: 97 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process