LIM2 anticorps (N-Term)

N° du produit ABIN635747

Détail du produit anti-LIM2 anticorps

Antigène: LIM2 (Lens Intrinsic Membrane Protein 2, 19kDa (LIM2))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LIM2 est non-conjugé

Application: Western Blotting (WB)

Specificité: LIM2 antibody was raised against the N terminal of LIM2

Purification: Affinity purified

Immunogène: LIM2 antibody was raised using the N terminal of LIM2 corresponding to a region with amino acids GSFAHQGLWRYCLGNKCYLQTDSIGEPPGQGPGRAWGKSRADLGAQGHLY

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LIM2 Blocking Peptide, catalog no. 33R-3559, is also available for use as a blocking control in assays to test for specificity of this LIM2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LIM2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LIM2

Antigène: LIM2 (Lens Intrinsic Membrane Protein 2, 19kDa (LIM2))

Autre désignation: LIM2 (LIM2 Produits)

Synonymes: anticorps 19kDa, anticorps 4833403J20, anticorps MP19, anticorps To3, anticorps MP20, anticorps Mp19, anticorps CTRCT19, anticorps MP17, anticorps lens intrinsic membrane protein 2, anticorps Lim2, anticorps LIM2

Sujet: This gene encodes an eye lens-specific protein found at the junctions of lens fiber cells, where it may contribute to cell junctional organization.

Poids moléculaire: 24 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization