LIM2 anticorps (N-Term)
-
- Antigène Voir toutes LIM2 Anticorps
- LIM2 (Lens Intrinsic Membrane Protein 2, 19kDa (LIM2))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp LIM2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- LIM2 antibody was raised against the N terminal of LIM2
- Purification
- Affinity purified
- Immunogène
- LIM2 antibody was raised using the N terminal of LIM2 corresponding to a region with amino acids GSFAHQGLWRYCLGNKCYLQTDSIGEPPGQGPGRAWGKSRADLGAQGHLY
- Top Product
- Discover our top product LIM2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
LIM2 Blocking Peptide, catalog no. 33R-3559, is also available for use as a blocking control in assays to test for specificity of this LIM2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LIM2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- LIM2 (Lens Intrinsic Membrane Protein 2, 19kDa (LIM2))
- Autre désignation
- LIM2 (LIM2 Produits)
- Synonymes
- anticorps 19kDa, anticorps 4833403J20, anticorps MP19, anticorps To3, anticorps MP20, anticorps Mp19, anticorps CTRCT19, anticorps MP17, anticorps lens intrinsic membrane protein 2, anticorps Lim2, anticorps LIM2
- Sujet
- This gene encodes an eye lens-specific protein found at the junctions of lens fiber cells, where it may contribute to cell junctional organization.
- Poids moléculaire
- 24 kDa (MW of target protein)
- Pathways
- Cell-Cell Junction Organization
-