alpha-N-Acetylgalactosaminide alpha-2,6-Sialyltransferase 3 (SIA7C) (C-Term) anticorps

N° du produit ABIN635748

Détail du produit

Antigène: alpha-N-Acetylgalactosaminide alpha-2,6-Sialyltransferase 3 (SIA7C)

Épitope: C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Inconjugué

Application: Western Blotting (WB)

Specificité: ST6 GALNAC3 antibody was raised against the C terminal of ST6 ALNAC3

Purification: Affinity purified

Immunogène: ST6 GALNAC3 antibody was raised using the C terminal of ST6 ALNAC3 corresponding to a region with amino acids HYYEQGRDECDEYFLHEHAPYGGHRFITEKKVFAKWAKKHRIIFTHPNWT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ST6GALNAC3 Blocking Peptide, catalog no. 33R-3882, is also available for use as a blocking control in assays to test for specificity of this ST6GALNAC3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ST0 ALNAC3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détail du antigène

Antigène: alpha-N-Acetylgalactosaminide alpha-2,6-Sialyltransferase 3 (SIA7C)

Autre désignation: ST6GALNAC3 (SIA7C Produits)

Synonymes: anticorps fb68h09, anticorps siat7c, anticorps st6GalNAc-III, anticorps wu:fb67c12, anticorps wu:fb68h09, anticorps zgc:73301, anticorps SIAT7C, anticorps PRO7177, anticorps ST6GALNACIII, anticorps STY, anticorps Siat7c, anticorps ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminide alpha-2,6-sialyltransferase 3, anticorps ST6 N-acetylgalactosaminide alpha-2,6-sialyltransferase 3, anticorps st6galnac3, anticorps ST6GALNAC3, anticorps St6galnac3

Sujet: ST6GALNAC3 belongs to a family of sialyltransferases that transfer sialic acids from CMP-sialic acid to terminal positions of carbohydrate groups in glycoproteins and glycolipids.

Poids moléculaire: 35 kDa (MW of target protein)