FLT3LG anticorps (N-Term)

N° du produit ABIN635754

Détail du produit anti-FLT3LG anticorps

Antigène: FLT3LG (Fms-Related tyrosine Kinase 3 Ligand (FLT3LG))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FLT3LG est non-conjugé

Application: Western Blotting (WB)

Specificité: Flt3 Ligand antibody was raised against the N terminal of FLT3 LG

Purification: Affinity purified

Immunogène: Flt3 Ligand antibody was raised using the N terminal of FLT3 LG corresponding to a region with amino acids TVLAPAWSPTTYLLLLLLLSSGLSGTQDCSFQHSPISSDFAVKIRELSDY

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Flt3 Ligand Blocking Peptide, catalog no. 33R-9360, is also available for use as a blocking control in assays to test for specificity of this Flt3 Ligand antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FLT0 G antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FLT3LG

Antigène: FLT3LG (Fms-Related tyrosine Kinase 3 Ligand (FLT3LG))

Autre désignation: Flt3 Ligand (FLT3LG Produits)

Synonymes: anticorps Flt3lg, anticorps Ly72L, anticorps FL, anticorps FLT3L, anticorps Vegfr3, anticorps fms related tyrosine kinase 3 ligand, anticorps FMS-like tyrosine kinase 3 ligand, anticorps fms-related tyrosine kinase 4, anticorps fms-related tyrosine kinase 3 ligand, anticorps FLT3LG, anticorps Flt3l, anticorps Flt4, anticorps Flt3lg

Sujet: FLT3LG stimulates the proliferation of early hematopoietic cells and synergizes well with a number of other colony stimulating factors and interleukins.

Poids moléculaire: 26 kDa (MW of target protein)

Pathways: Signalisation RTK