PGAP3 anticorps (N-Term)

N° du produit ABIN635756

Détail du produit anti-PGAP3 anticorps

Antigène: PGAP3 (Post-GPI Attachment To Proteins 3 (PGAP3))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PGAP3 est non-conjugé

Application: Western Blotting (WB)

Specificité: PERLD1 antibody was raised against the N terminal of PERLD1

Purification: Affinity purified

Immunogène: PERLD1 antibody was raised using the N terminal of PERLD1 corresponding to a region with amino acids AGLAARLVLLAGAAALASGSQGDREPVYRDCVLQCEEQNCSGGALNHFRS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PERLD1 Blocking Peptide, catalog no. 33R-1204, is also available for use as a blocking control in assays to test for specificity of this PERLD1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PERLD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PGAP3

Antigène: PGAP3 (Post-GPI Attachment To Proteins 3 (PGAP3))

Autre désignation: PERLD1 (PGAP3 Produits)

Synonymes: anticorps GB10206, anticorps AGLA546, anticorps CAB2, anticorps PER1, anticorps PERLD1, anticorps PP1498, anticorps D430035D22Rik, anticorps Perld1, anticorps perld1, anticorps pgap3, anticorps post-GPI attachment to proteins factor 3, anticorps post-GPI attachment to proteins 3, anticorps post-GPI attachment to proteins 3 L homeolog, anticorps LOC412085, anticorps PGAP3, anticorps Pgap3, anticorps pgap3.L, anticorps pgap3

Sujet: PERLD1 is involved in the lipid remodeling steps of GPI-anchor maturation. Lipid remodeling steps consist in the generation of 2 saturated fatty chains at the sn-2 position of GPI-anchors proteins.

Poids moléculaire: 36 kDa (MW of target protein)

Pathways: Inositol Metabolic Process