Tetraspanin 5 anticorps (Middle Region)

N° du produit ABIN635758

Détail du produit anti-Tetraspanin 5 anticorps

Antigène: Tetraspanin 5 (TSPAN5)

Épitope: Middle Region

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Tetraspanin 5 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: Tetraspanin 5 antibody was raised against the middle region of TSPAN5

Purification: Affinity purified

Immunogène: Tetraspanin 5 antibody was raised using the middle region of TSPAN5 corresponding to a region with amino acids ASRERCGVPFSCCTKDPAEDVINTQCGYDARQKPEVDQQIVIYTKGCVPQ

Information d'application

Indications d'application: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Tetraspanin 5 Blocking Peptide, catalog no. 33R-1526, is also available for use as a blocking control in assays to test for specificity of this Tetraspanin 5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TSPAN5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Tetraspanin 5

Antigène: Tetraspanin 5 (TSPAN5)

Autre désignation: Tetraspanin 5 (TSPAN5 Produits)

Synonymes: anticorps net4, anticorps net-4, anticorps tm4sf9, anticorps tspan-5, anticorps MGC84872, anticorps tspan5, anticorps zgc:103404, anticorps MGC145322, anticorps NET-4, anticorps NET4, anticorps TM4SF9, anticorps TSPAN-5, anticorps 2810455A09Rik, anticorps 4930505M03Rik, anticorps AU024142, anticorps Tm4sf9, anticorps Tspan-5, anticorps tetraspanin 5 S homeolog, anticorps tetraspanin 5, anticorps tetraspanin 5a, anticorps tetraspanin-3, anticorps tetraspanin 5 L homeolog, anticorps tspan5.S, anticorps TSPAN5, anticorps tspan5a, anticorps LOC725690, anticorps tspan5, anticorps tspan5.L, anticorps Tspan5

Sujet: TSPAN5 is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility.

Poids moléculaire: 30 kDa (MW of target protein)