Tetraspanin 15 anticorps (C-Term)

N° du produit ABIN635763

Détail du produit anti-Tetraspanin 15 anticorps

Antigène: Tetraspanin 15 (TSPAN15)

Épitope: C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Tetraspanin 15 est non-conjugé

Application: Western Blotting (WB)

Specificité: Tetraspanin 15 antibody was raised against the C terminal of TSPAN15

Purification: Affinity purified

Immunogène: Tetraspanin 15 antibody was raised using the C terminal of TSPAN15 corresponding to a region with amino acids LGILLPQFLGVLLTLLYITRVEDIIMEHSVTDGLLGPGAKPSVEAAGTGC

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Tetraspanin 15 Blocking Peptide, catalog no. 33R-4975, is also available for use as a blocking control in assays to test for specificity of this Tetraspanin 15 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TSPAN15 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Tetraspanin 15

Antigène: Tetraspanin 15 (TSPAN15)

Autre désignation: Tetraspanin 15 (TSPAN15 Produits)

Synonymes: anticorps MGC82964, anticorps zgc:110375, anticorps 2700063A19Rik, anticorps NET-7, anticorps NET7, anticorps TM4SF15, anticorps 1110036D12Rik, anticorps AW048364, anticorps Tm4sf15, anticorps tetraspanin 15, anticorps tetraspanin 15 L homeolog, anticorps TSPAN15, anticorps tspan15.L, anticorps tspan15, anticorps Tspan15

Sujet: TSPAN15 is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. The use of alternate polyadenylation sites has been found for this gene.

Poids moléculaire: 33 kDa (MW of target protein)