ZP4 anticorps (N-Term)

N° du produit ABIN635764

Détail du produit anti-ZP4 anticorps

Antigène: ZP4 (Zona Pellucida Glycoprotein 4 (ZP4))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ZP4 est non-conjugé

Application: Western Blotting (WB)

Specificité: ZP4 antibody was raised against the N terminal of ZP4

Purification: Affinity purified

Immunogène: ZP4 antibody was raised using the N terminal of ZP4 corresponding to a region with amino acids MWLLRCVLLCVSLSLAVSGQHKPEAPDYSSVLHCGPWSFQFAVNLNQEAT

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ZP4 Blocking Peptide, catalog no. 33R-6616, is also available for use as a blocking control in assays to test for specificity of this ZP4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZP4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ZP4

Antigène: ZP4 (Zona Pellucida Glycoprotein 4 (ZP4))

Autre désignation: ZP4 (ZP4 Produits)

Synonymes: anticorps ZPB, anticorps xlZPB, anticorps lzpb-a, anticorps MGC154827, anticorps zbp, anticorps zp1, anticorps ZBP, anticorps TAC4, anticorps MGC154888, anticorps ZP1, anticorps Zp-4, anticorps ZP3-ALPHA, anticorps ZP, anticorps Zp-X, anticorps zona pellucida glycoprotein 4 S homeolog, anticorps zona pellucida glycoprotein 4, anticorps zona pellucida glycoprotein 4 L homeolog, anticorps zp4.S, anticorps zp4, anticorps ZP4, anticorps zp4.L, anticorps Zp4

Sujet: The zona pellucida is an extracellular matrix that surrounds the oocyte and early embryo. It is composed primarily of three or four glycoproteins with various functions during fertilization and preimplantation development. It is hypothesized that furin cleavage results in release of the mature protein from the plasma membrane for subsequent incorporation into the zona pellucida matrix.

Poids moléculaire: 49 kDa (MW of target protein)