CJ057 anticorps (Middle Region)

N° du produit ABIN635765

Détail du produit anti-CJ057 anticorps

Antigène: CJ057 (C10ORF57) (Chromosome 10 Open Reading Frame 57 (C10ORF57))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CJ057 est non-conjugé

Application: Western Blotting (WB)

Specificité: C10 ORF57 antibody was raised against the middle region of C10 rf57

Purification: Affinity purified

Immunogène: C10 ORF57 antibody was raised using the middle region of C10 rf57 corresponding to a region with amino acids QSIPYQNLGPLGPFTQYLVDHHHTLLCNGYWLAWLIHVGESLYAIVLCKH

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C10ORF57 Blocking Peptide, catalog no. 33R-7727, is also available for use as a blocking control in assays to test for specificity of this C10ORF57 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF57 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CJ057

Antigène: CJ057 (C10ORF57) (Chromosome 10 Open Reading Frame 57 (C10ORF57))

Autre désignation: C10ORF57 (C10ORF57 Produits)

Synonymes: anticorps MGC131362, anticorps C10orf57, anticorps bA369J21.6, anticorps transmembrane protein 254, anticorps transmembrane protein 254 L homeolog, anticorps TMEM254, anticorps tmem254, anticorps tmem254.L

Sujet: C10orf57 encodes a transmembrane protein.

Poids moléculaire: 14 kDa (MW of target protein)