TMEM35 anticorps (C-Term)

N° du produit ABIN635766

Détail du produit anti-TMEM35 anticorps

Antigène: TMEM35 (Transmembrane Protein 35 (TMEM35))

Épitope: C-Term

Reactivité: Souris, Humain, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TMEM35 est non-conjugé

Application: Western Blotting (WB)

Specificité: TMEM35 antibody was raised against the C terminal of TMEM35

Purification: Affinity purified

Immunogène: TMEM35 antibody was raised using the C terminal of TMEM35 corresponding to a region with amino acids VFGILLTCRLLIARKPEDRSSEKKPLPGNAEEQPSLYEKAPQGKVKVS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TMEM35 Blocking Peptide, catalog no. 33R-9525, is also available for use as a blocking control in assays to test for specificity of this TMEM35 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM35 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TMEM35

Antigène: TMEM35 (Transmembrane Protein 35 (TMEM35))

Autre désignation: TMEM35 (TMEM35 Produits)

Synonymes: anticorps Xp18, anticorps flj14084, anticorps wu:fc41e12, anticorps zgc:110832, anticorps 9030603L14Rik, anticorps AI841526, anticorps PMP52, anticorps RSEP4, anticorps transmembrane protein 35A, anticorps transmembrane protein 35, anticorps TMEM35A, anticorps tmem35, anticorps tmem35a, anticorps Tmem35, anticorps TMEM35, anticorps Tmem35a

Sujet: TMEM35 is a multi-pass membrane protein. The exact function of TMEM35 remains unknown.

Poids moléculaire: 18 kDa (MW of target protein)