XYLT2 anticorps (C-Term)

N° du produit ABIN635768

Détail du produit anti-XYLT2 anticorps

Antigène: XYLT2 (Xylosyltransferase II (XYLT2))

Épitope: C-Term

Reactivité: Souris, Humain, Chien, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp XYLT2 est non-conjugé

Application: Western Blotting (WB)

Specificité: XYLT2 antibody was raised against the C terminal of XYLT2

Purification: Affinity purified

Immunogène: XYLT2 antibody was raised using the C terminal of XYLT2 corresponding to a region with amino acids LRPGPWTVRLLQFWEPLGETRFLVLPLTFNRKLPLRKDDASWLHAGPPHN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

XYLT2 Blocking Peptide, catalog no. 33R-5377, is also available for use as a blocking control in assays to test for specificity of this XYLT2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of XYLT2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur XYLT2

Antigène: XYLT2 (Xylosyltransferase II (XYLT2))

Autre désignation: XYLT2 (XYLT2 Produits)

Synonymes: anticorps MGC89331, anticorps PXYLT2, anticorps XT-II, anticorps XT2, anticorps xylT-II, anticorps xt-II, anticorps E030002B02Rik, anticorps xylt-II, anticorps xylosyltransferase II, anticorps xylosyltransferase 2, anticorps xylt2, anticorps XYLT2, anticorps Xylt2

Sujet: XYLT2 is an isoform of xylosyltransferase, which belongs to a family of glycosyltransferases. This enzyme transfers xylose from UDP-xylose to specific serine residues of the core protein and initiates the biosynthesis of glycosaminoglycan chains in proteoglycans including chondroitin sulfate, heparan sulfate, heparin and dermatan sulfate. The enzyme activity, which is increased in scleroderma patients, is a diagnostic marker for the determination of sclerotic activity in systemic sclerosis.

Poids moléculaire: 97 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process